Same day dispatch Card & Apple Pay accepted

Tesamorelin research product — Australian Peptide Labs
Quantity save up to 15%

$110.00

1 × $110.00 pick 2 and save $11.00

Same day dispatch · free express shipping over $250

Testing & Certificates

Tested twice · two labs
Our laboratory 98.70%HPLC / MS · batch TES10-2608-03
Independent lab 98.15%UPLC-MS/MS · lot TESA10-2608-01

Ozcanium Analytics

Independent Australian laboratory. One report covers every vial size; each opens as issued.

Purity & identity

98.15%

Analysed
24 August 2026
Method
UPLC-MS/MS
Lot
APL-TESA10-2608-01
Net content
9.71 mg
Code
OZ-HPLCMS-AL99
Open purity reportPDF (opens in a new tab)

Bacterial endotoxin

< 15.0EU/vial

Below the reportable limit at the dilution tested

Analysed
24 August 2026
Method
kinetic chromogenic LAL
Code
OZ-ENDOTX-1APL
Open endotoxin reportPDF (opens in a new tab)

Enter a code in the Ozcanium verification portal (opens in a new tab) to confirm either report against the lab's own records.

Full verification statement

Tesamorelin is independently verified by Ozcanium Analytics, an independent Australian laboratory, at 98.15% purity by UPLC-MS/MS, analysed 24 August 2026 on lot APL-TESA10-2608-01, net content 9.71 mg, verification code OZ-HPLCMS-AL99; bacterial endotoxin below 15.0 EU per vial by kinetic chromogenic LAL, analysed 24 August 2026, verification code OZ-ENDOTX-1APL.

Molecular Details

Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula:C221H366N72O67S
Molecular Weight:5135.8 Da
Purity:98.70%
CAS Number:218949-48-5
Form:Lyophilised powder
Appearance:White/off-white lyophilised powder

Usage & Storage

Quantity:10mg / vial
Reconstitution:Reconstitute with 2mL bacteriostatic water. Swirl gently; do not shake. Allow to stand until fully dissolved.
Storage Temp:-20°C for long-term storage
Storage Conditions:Store lyophilised powder at -20°C, protected from light and moisture. After reconstitution, refrigerate at 2-8°C and use within 28 days.
Packaging:Sterile, tamper-evident research vial

Description

Synthetic GHRH analogue that stimulates endogenous GH release. Studied in body-composition, metabolic, and cognitive research.

  • Synthetic GHRH analogue (44 aa, trans-3-hexenoyl N-terminus)
  • Studied in GH-release research
  • Preserves somatostatin feedback loop
  • COA on every batch; select batches third-party verified
  • Research Grade purity >=98%

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH) consisting of the full 44 amino acid sequence of endogenous GHRH with a trans-3-hexenoic acid moiety attached to the N-terminus for enhanced stability. It binds to pituitary GHRH receptors to stimulate natural pulsatile growth hormone release while preserving somatostatin feedback mechanisms. Research has investigated its applications in visceral-adiposity, lean-mass, lipid-metabolism, and cognitive-function research.

Frequently Asked Questions

Is Tesamorelin legal to buy in Australia?

Tesamorelin is supplied strictly as a research chemical for in-vitro laboratory use. It is not approved for human therapeutic use in Australia and is not for human or animal consumption. Researchers are responsible for compliance with Therapeutic Goods Administration (TGA) regulations and their institution's protocols.

Is Tesamorelin third-party tested?

Yes. Every batch is analysed in-house by HPLC and mass spectrometry. Tesamorelin is independently verified by Ozcanium Analytics, an independent Australian laboratory, at 98.15% purity by UPLC-MS/MS, analysed 24 August 2026 on lot APL-TESA10-2608-01, net content 9.71 mg, verification code OZ-HPLCMS-AL99; bacterial endotoxin below 15.0 EU per vial by kinetic chromogenic LAL, analysed 24 August 2026, verification code OZ-ENDOTX-1APL. The reports are published in full on this page, and each verification code can be redeemed in the laboratory's own portal, so the document is confirmed against their records rather than ours.

What purity is Tesamorelin?

We specify ≥98% purity — the High-Tier Research Grade (commercial RUO) standard. Every batch is analysed in-house by HPLC and mass spectrometry and ships with a Certificate of Analysis, and Tesamorelin is independently verified by Ozcanium Analytics at 98.15% purity by UPLC-MS/MS, analysed 24 August 2026.

Does Tesamorelin ship with a Certificate of Analysis (COA)?

Yes — every batch ships with a batch-specific COA documenting HPLC purity and mass-spectrometry identity. 3 Tesamorelin batch certificates are published in full at australianpeptidelabs.com.au/certificates/tesamorelin, so the analysis can be read before ordering and the batch number printed on the vial matched against it.

Where can I buy Tesamorelin in Australia?

Tesamorelin can be ordered here from Australian Peptide Labs for in-vitro research use, dispatched same day from within Australia with a COA included.

Do you provide dosing or administration guidance for Tesamorelin?

No. As these compounds are supplied for laboratory research only, we do not provide dosing or administration protocols. Our research library covers reconstitution and concentration calculations for in-vitro work.